PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C012848P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family G2-like
Protein Properties Length: 483aa    MW: 53616.6 Da    PI: 5.2477
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C012848P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like107.57.4e-34267321155
         G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                     kpr+rWtpeLH++Fveav++LGGse+AtPk +l+lm+v+gLt++hvkSHLQkYR+
  MELO3C012848P1 267 KPRMRWTPELHDAFVEAVNKLGGSERATPKGVLKLMQVEGLTIYHVKSHLQKYRT 321
                     79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.453264324IPR017930Myb domain
SuperFamilySSF466897.7E-18265321IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.7E-31266323IPR009057Homeodomain-like
TIGRFAMsTIGR015574.7E-25267321IPR006447Myb domain, plants
PfamPF002492.4E-10269320IPR001005SANT/Myb domain
PfamPF143793.3E-26353399IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007623Biological Processcircadian rhythm
GO:0016036Biological Processcellular response to phosphate starvation
GO:0055063Biological Processsulfate ion homeostasis
GO:0071486Biological Processcellular response to high light intensity
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 483 aa     Download sequence    Send to blast
MKYVPYFDSR MKIEASPALS IPSSNARQHN SAGVNKEISK SLRVLLPTSS EEVYPKLPDS  60
QQVSMERELV SRPLVHSNHV HSSSGVVGHI FSSSPGFSTD LHYSSVSLYE NQSDSPFIPE  120
SSANGAMLHS HSEILSSTNH PNSENANSWC SDALPGFLEV PENNPVGNSR VENNSCSSLL  180
VSDDFSKEND WQEWTDRLMT DDSLTSNWSD LLVDANVADL EPKMEHQASK PSIKMPVQQV  240
QVQNQLPSSG EIPMISTTTS SNGAPSKPRM RWTPELHDAF VEAVNKLGGS ERATPKGVLK  300
LMQVEGLTIY HVKSHLQKYR TARYQPESSK GSMDKSTTPL EDISSLDLKT SIDITEALRL  360
QMEVQKRLHE QLEIQRNLQL RIEEQGKYLQ MMFEKQCKSS NKLNKPSTST LEDSPFSDSV  420
LETSQVENRT VHTGPSEADS IAGKATDEVV EKFIDPQKDA PENPKSDVSE ASFQLSKRQR  480
TE*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818270.0LN681827.1 Cucumis melo genomic scaffold, anchoredscaffold00018.
GenBankLN7132580.0LN713258.1 Cucumis melo genomic chromosome, chr_4.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008447384.10.0PREDICTED: protein PHR1-LIKE 1
TrEMBLA0A0A0L8L30.0A0A0A0L8L3_CUCSA; Uncharacterized protein
STRINGPOPTR_0002s25960.11e-176(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF15123498
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G28610.11e-98phosphate starvation response 1